PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G00380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 315aa    MW: 34107.2 Da    PI: 10.1858
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G00380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97e-3155108255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  OPUNC12G00380.1  55 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 108
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9251111IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2951109IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1552109IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2254110IPR006447Myb domain, plants
PfamPF002491.2E-856107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGSAGKEEED GGGGAPAAAN NDGSSTSSTT VEEGDSGQRT SSSSSVRPYV RSKNPRLRWT  60
PELHLSFVRA VDRLGGQDRA TPKLVLQLMN VRGLSIGHVK SHLQMYRSKK IDESGQVIGG  120
ESWRSDDHLQ MRGGGHGGQA YNLGHLSLPA LHHRSITAGS GLAIHGPHGD VMDHTGSVQA  180
ITCLLDQNPI MTHHQQLKLR LLSIDQVLVR VVTIKKALLI SISHSISVRG ARRGRENSAG  240
GNKRKLMIML LVVIKKQRVV LLGSLFLCSD HVTPVERCII RVLPVLYCCA VLACSLVIYQ  300
ISLVRSYAIV DDKSN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411710.0AK241171.1 Oryza sativa Japonica Group cDNA, clone: J065117O05, full insert sequence.
GenBankGU0467890.0GU046789.1 Oryza sativa Japonica Group cultivar Dongjin-byeo myb-like DNA-binding domain-containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663145.13e-66PREDICTED: transcription activator GLK2-like
TrEMBLA0A0E0MIN50.0A0A0E0MIN5_ORYPU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.19e-39G2-like family protein